PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02155.1.p
Common NameEUGRSUZ_B02155, LOC104432550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 372aa    MW: 40932.6 Da    PI: 4.9815
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02155.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.6e-33173227155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtp+LHe+Fveav+qLGG ++AtPk +l+lm+v++Lt++hvkSHLQkYR+
  Eucgr.B02155.1.p 173 KARMRWTPDLHEAFVEAVNQLGGGDRATPKGVLKLMNVESLTIYHVKSHLQKYRT 227
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575118No hitNo description
PROSITE profilePS5129411.41170230IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-32171229IPR009057Homeodomain-like
SuperFamilySSF466894.84E-18171227IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25173227IPR006447Myb domain, plants
PfamPF002495.1E-10175226IPR001005SANT/Myb domain
PfamPF143792.9E-22260306IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MLSKNGTVGS GLSSASGCTS DICFSSPQQH ERHGQYSPFI SSTSMIRTST PPVGFPRTEV  60
QVTALTDIPK EIKDVPWDPN QLQDFLYSEN VPSQNVQLGS RAAVMGCDNQ SAGSDLIWTE  120
NFGEAMDLDW SKFLADDDAI DPSKPPLAVQ GQSLPPAESS AAANQLSSAP SSKARMRWTP  180
DLHEAFVEAV NQLGGGDRAT PKGVLKLMNV ESLTIYHVKS HLQKYRTARY KPDSAESEGS  240
SEKKLSSLED MKSLDLKTTM NITEALRMQM EVQKQLHEQL EIQRKLQLRI EEQGRCLQML  300
FEKQRNQTEA TEQPQAEKGL ETTNPSSSPG ESSLNMNKRQ KVSEARTTDD DNPDEGEIGL  360
PSPKRVRGHE P*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02155.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043308.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN51e-69PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A059D5200.0A0A059D520_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s03750.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.21e-58G2-like family protein